
IGF-1 LR3 1mg
Research-grade IGF-1 LR3 1mg. 99% purity, third-party tested with published COA.
Ships from USA
1–3 day delivery
Free Shipping
On orders $150+
Peptide Handling & Storage Guide
Storage temperature, shelf life & reconstitution (PDF)
99%+ Purity
COA included
Same-Day Shipping
Orders before 2PM EST
Secure Checkout
SSL encrypted
Shipment Protection
Lost or damaged — reshipped free
Compound Information
- Type
- Long-acting IGF-1 analog (83-aa recombinant protein)
- Molecular Formula
- C400H625N111O115S9
- Molecular Weight
- 9111.6 g/mol
- CAS Number
- 143045-27-6
- Purity
- 99%
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (13-aa N-ext + IGF-1(1-70), Arg3)
- Also known as
- Long R3 IGF-1, Long [Arg3]-IGF-I
Reference chemistry (free base) from public chemical databases and peer-reviewed literature. For laboratory research identification only.
Research Use Only. This vial is bound for the lab bench — supplied for in-vitro scientific work exclusively, never for administration to any person or animal.
Research & References
Independent databases and peer-reviewed literature for IGF-1 LR3. Provided for research reference only.
External resources are independent and not affiliated with or endorsed by PHIOGEN. Listed for laboratory research reference only.



